PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 918840
Common NameARALYDRAFT_918840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 235aa    MW: 25445.8 Da    PI: 10.2302
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
918840genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.61.2e-1292136347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I+r    ++++ q+ s+ qky
           918840  92 PWTEEEHRTFLVGLEKLGKGDWRGISRNYVVTKSPTQVASHAQKY 136
                      8*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.36284141IPR017930Myb domain
SuperFamilySSF466892.92E-1687141IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-1888140IPR006447Myb domain, plants
SMARTSM007171.7E-989139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-989135IPR009057Homeodomain-like
PfamPF002498.1E-1192136IPR001005SANT/Myb domain
CDDcd001673.94E-992137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGRRCSHCGN VGHNSRTCSS YHTRVIRLFG VHLDTTSSSP PPPPPPSILA AAMKKSFSMD  60
CLPACSSSSS SFAGYLSDGL AHKTPDRKKG VPWTEEEHRT FLVGLEKLGK GDWRGISRNY  120
VVTKSPTQVA SHAQKYFLRQ TTTLHHKRRR TSLFDMVSAG NVEENSTIKS ICNDHIGSTS  180
KVVWKQGLLN PRLGYPDPKV TVSGSGNSGG GLDLELKLAS IQSPESNIRP ISVT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195170.0AY519517.1 Arabidopsis thaliana MYB transcription factor (At5g56840) mRNA, complete cds.
GenBankBT0125280.0BT012528.1 Arabidopsis thaliana At5g56840 gene, complete cds.
GenBankBT0149560.0BT014956.1 Arabidopsis thaliana At5g56840 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002864483.11e-174DNA-binding family protein
TrEMBLD7MM751e-174D7MM75_ARALL; DNA-binding family protein
STRINGscaffold_802240.11e-174(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54962747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.11e-145MYB_related family protein